PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016436497.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 495aa    MW: 56706.3 Da    PI: 10.5394
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016436497.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.5e-081147138
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
                     +++W t+E+++l  av+++G+++W+ +a+++   Rt +
   XP_016436497.1 11 KMNWGTWEELILGGAVRRHGTRDWNVVASELR-ARTVY 47
                     689*****************************.88865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.89E-5765IPR009057Homeodomain-like
PROSITE profilePS500906.2721064IPR017877Myb-like domain
PfamPF002491.6E-61146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-51162IPR009057Homeodomain-like
CDDcd001673.61E-41360No hitNo description
SuperFamilySSF473707.2E-18255370IPR001487Bromodomain
SMARTSM002972.9E-16266370IPR001487Bromodomain
Gene3DG3DSA:1.20.920.103.9E-16269390IPR001487Bromodomain
PfamPF004392.1E-10275354IPR001487Bromodomain
PROSITE profilePS5001410.498281351IPR001487Bromodomain
CDDcd043698.75E-15282365No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MEGEMDVGPR KMNWGTWEEL ILGGAVRRHG TRDWNVVASE LRARTVYPYC FTPEACRTRY  60
EDLRKRYSGC NAWFEELRKR RVEELKRELE RSESSIGFLE SKIESLKAER EQSDQIDYGL  120
SRTESPAPPT KSEDIESFVK DEAKDGLSAG SFTLDIRTNQ SPESQVPTIP LTDVKLERSE  180
SCERDKVPST SKVTEASNGN GGAVRKRRGK RRRKDAVWDA KEGSIEESDN VCSTSLASTS  240
HCKEALTSCE HSIRHSPVND HRGGLSRFRN DDLMRIFTSI TLHEAAMVFR HRLDSQKRAR  300
YKKMIRRHMD IETVKSRLAS WSIKTPGELF RDFLLLANNA MVFYSKRTRE YKAAMALRDI  360
VTRAYRQHYK GSYYKATSSL LPFPTIGNPP GKPRSVRPRP SKDKLQAKYG NNVKDNIAGK  420
LGRQNHRPGD ADSKVPLQSW LSAKKGFKRP GKIKRGPILE SVNPQVKEST QHNIKVKEDH  480
RIKPVTKERK RARQK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16380RKRYSGCNAWFEELRKRR
2206214RRGKRRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016436497.10.0PREDICTED: uncharacterized protein LOC107762639 isoform X1
TrEMBLM1C1L50.0M1C1L5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000577580.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55341924
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60110.19e-13DNA-binding bromodomain-containing protein